1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Biliary Glycoprotein/CD66a
  6. CEACAM1 Protein, Rat (HEK293, His)

CEACAM1 protein is involved in the regulation of hepatic lipogenesis and inhibition of cell proliferation. It interacts with INSR to reduce fatty acid synthesis and with SHC1 to inhibit cell proliferation. CEACAM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CEACAM1 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEACAM1 protein is involved in the regulation of hepatic lipogenesis and inhibition of cell proliferation. It interacts with INSR to reduce fatty acid synthesis and with SHC1 to inhibit cell proliferation. CEACAM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CEACAM1 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The CD31/PECAM-1 protein, a pivotal cell adhesion molecule, is indispensable for leukocyte transendothelial migration (TEM) in the majority of inflammatory scenarios. The critical role of Tyr-690 in TEM is highlighted by its involvement in the efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC), essential for targeting the LBRC membrane around migrating leukocytes. This protein engages in trans-homophilic interactions that likely contribute to endothelial cell-cell adhesion through cell junctions, while its heterophilic interaction with CD177 plays a crucial role in the transendothelial migration of neutrophils. Homophilic ligation of PECAM1 serves a dual purpose, preventing macrophage-mediated phagocytosis of neighboring viable leukocytes by transmitting a detachment signal, while simultaneously promoting macrophage-mediated phagocytosis of apoptotic leukocytes by tethering them to the phagocytic cells. Beyond its role in cell adhesion, CD31/PECAM-1 modulates bradykinin receptor BDKRB2 activation and regulates ERK1/2 activation in endothelial cells induced by bradykinin and hyperosmotic shock. Despite its versatility, CD31/PECAM-1 has a notable impact on atherosclerosis susceptibility while lacking a protective effect against apoptosis. This underscores the multifaceted functions of CD31/PECAM-1 in orchestrating diverse aspects of immune and endothelial cell responses.

Species

Rat

Source

HEK293

Tag

C-10*His

Accession

P16573-1 (Q35-S422)

Gene ID
Molecular Construction
N-term
CEACAM1 (Q35-S422)
Accession # P16573-1
10*His
C-term
Synonyms
Carcinoembryonic antigen-related cell adhesion molecule 1; BGP-1; CD66a; CEACAM1
AA Sequence

QVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLS

Molecular Weight

66-76 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P75358
Quantity:
MCE Japan Authorized Agent: