1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serine/Threonine Kinase Proteins
  4. CDK4 Protein, Human (sf9, His, Flag, Avi)

CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G(1)/S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G(1) phase, releases E2F and promotes transcription of genes that drive G(1) progression. CDK4 Protein, Human (sf9, His, Flag, Avi) is the recombinant human-derived CDK4 protein, expressed by Sf9 insect cells, with Avi and N-His and N-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G(1)/S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G(1) phase, releases E2F and promotes transcription of genes that drive G(1) progression. CDK4 Protein, Human (sf9, His, Flag, Avi) is the recombinant human-derived CDK4 protein, expressed by Sf9 insect cells, with Avi and N-His and N-Flag labeled tag.

Background

CDK4 protein serves as the Ser/Thr-kinase component within cyclin D-CDK4 (DC) complexes, orchestrating the phosphorylation and inhibition of members belonging to the retinoblastoma (RB) protein family, including RB1. This regulatory activity is pivotal in controlling the cell cycle during the G(1)/S transition. The phosphorylation of RB1 instigates the dissociation of the transcription factor E2F from the RB/E2F complexes, facilitating the subsequent transcription of E2F target genes that drive progression through the G(1) phase. Particularly notable is the hypophosphorylation of RB1 occurring in early G(1) phase. As essential integrators of diverse mitogenic and antimitogenic signals, cyclin D-CDK4 complexes play a central role in cell cycle regulation. Additionally, CDK4 protein exhibits the capability to phosphorylate SMAD3 in a cell-cycle-dependent manner, thereby repressing its transcriptional activity. CDK4 is a crucial component of the ternary complex, cyclin D/CDK4/CDKN1B, which is indispensable for the nuclear translocation and activity of the cyclin D-CDK4 complex.

Species

Human

Source

Sf9 insect cells

Tag

Avi;N-His;N-Flag

Accession

P11802-1 (M1-E303)

Gene ID

1019

Molecular Construction
N-term
His-Flag-Avi
CDK4
Accession # P11802
C-term
Protein Length

Full Length of Isoform-1

Synonyms
CDK4; Cell division protein kinase 4; CMM3; PSK-J3
AA Sequence

MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Predicted Molecular Mass
38.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CDK4 Protein, Human (sf9, His, Flag, Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK4 Protein, Human (sf9, His, Flag, Avi)
Cat. No.:
HY-P704003
Quantity:
MCE Japan Authorized Agent: