1. Recombinant Proteins
  2. Others
  3. CDC42 Protein, Human (Active, GST-His)

CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (Active, GST-His) is the recombinant human-derived CDC42 protein, expressed by E. coli, with N-His and N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (Active, GST-His) is the recombinant human-derived CDC42 protein, expressed by E. coli, with N-His and N-GST labeled tag.

Background

CDC42, a plasma membrane-associated small GTPase, dynamically transitions between an active GTP-bound state and an inactive GDP-bound state, modulating diverse cellular responses by interacting with various effector proteins. Notably, CDC42 is intricately involved in processes such as epithelial cell polarization, where it plays a critical role in regulating spindle microtubule attachment to kinetochores before chromosome congression in metaphase. Additionally, CDC42 influences cell migration and is pivotal for the extension and maintenance of filopodia, slender actin-rich projections, in neurons. In the context of neuronal plasticity, it participates in CaMKII-mediated signaling, impacting dendritic spine structural plasticity and contributing to long-term synaptic changes. Moreover, CDC42 is essential for the formation of spines in specific neuronal cell types, such as Purkinje cells and hippocampal neurons, through interactions with DOCK10 and DOCK11. In podocytes, it facilitates the formation of filopodia and podosomes upon activation by DOCK11. Furthermore, CDC42 plays a crucial role in the orchestration of F-actin cytoskeleton dynamics during phagocytosis, contributing to the formation of phagocytic cups. This multifaceted engagement underscores the versatility of CDC42 in regulating various cellular functions.

Species

Human

Source

E. coli

Tag

N-His;N-GST

Accession

P60953-2 (M1-L191)

Gene ID

998

Molecular Construction
N-term
His
GST
CDC42 (M1-L191)
Accession # P60953-2
C-term
Protein Length

Full Length

Synonyms
CDC42; Cell division control protein 42 homolog; G25K GTP-binding protein
AA Sequence

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Predicted Molecular Mass
48 kDa
Molecular Weight

Approximately 48 kDa,based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Documentation

CDC42 Protein, Human (Active, GST-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDC42 Protein, Human (Active, GST-His)
Cat. No.:
HY-P704540
Quantity:
MCE Japan Authorized Agent: