1. Recombinant Proteins
  2. CD Antigens
  3. CD99L2 Protein, Mouse (HEK293, His)

CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD99L2 protein plays a vital role in facilitating a late step of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane barrier. It acts at the same site as PECAM1, although independently, to promote this process. CD99L2 functions as a homophilic adhesion molecule, although its interactions may not be necessary for cell aggregation.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD99L2 is coated at 2 µg/mL (100 µL/well) can blind Recombinant Mouse CD99L2. The ED50 for this effect is 1.762 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD99L2 is coated at 2 µg/mL (100 µL/well) can blind Recombinant Mouse CD99L2 .The ED50 for this effect is 1.762 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8BIF0-1 (D26-A164)

Gene ID
Molecular Construction
N-term
CD99L2 (D26-A164)
Accession # Q8BIF0
His
C-term
Synonyms
CD99 Antigen-Like Protein 2; MIC2-Like Protein 1; CD99; CD99L2; MIC2L1
AA Sequence

DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIA

Molecular Weight

Approximately 24-30 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD99L2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD99L2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76814
Quantity:
MCE Japan Authorized Agent: