1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins Monocyte CD Proteins Signal Transduction-related CD Proteins
  4. CD84
  5. CD84/SLAMF5 Protein, Mouse (HEK293, His)

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

CD84, a member of the signaling lymphocytic activation molecule (SLAM) family, functions as a self-ligand receptor involved in the intricate regulation of immune responses. Through homo- or heterotypic cell-cell interactions, SLAM receptors, including CD84, modulate the activation and differentiation of diverse immune cells, contributing to the coordination of both innate and adaptive immune responses. The activities of CD84 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, such as SH2D1A/SAP and SH2D1B/EAT-2. CD84 plays a role in natural killer (NK) cell cytotoxicity, T-cell proliferation, interferon gamma (IFNG) secretion, platelet stimulation, and is implicated as a marker for hematopoietic progenitor cells. Furthermore, CD84 is essential for T-cell:B-cell interactions, optimal T follicular helper function, germinal center formation, and maintenance of B cell tolerance in germinal centers, preventing autoimmunity. In mast cells, CD84 negatively regulates high-affinity immunoglobulin epsilon receptor signaling, while in macrophages, it positively regulates LPS-induced MAPK phosphorylation and NF-kappaB activation. Additionally, CD84 plays a role in enhancing macroautophagy in primary dendritic cells by stabilizing IRF8. CD84 forms homodimers via its extracellular domain and engages in head-to-tail dimers with CD48 molecules from other cells. It interacts with various proteins, including SH2 domain-containing proteins, tyrosine-protein phosphatases, and is subject to complex regulatory mechanisms involving phosphorylation and adapter proteins.

Biological Activity

Measured in a cell proliferation assay using PHA stimulated Mouse T cells in the presence of anti-CD3. The ED50 for this effect is 0.5203 µg/mL in the presence of anti-CD3 immobilized at 20 ng/mL, corresponding to a specific activity is 1.922×10^3 units/mg.

  • Measured in a cell proliferation assay using PHA stimulated Mouse T cells in the presence of anti-CD3. The ED50 for this effect is 0.5203 µg/mL in the presence of anti-CD3 immobilized at 20 ng/mL, corresponding to a specific activity is 1.922×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

Q18PI6-1 (K22-V221)

Gene ID

12523

Molecular Construction
N-term
CD84 (K22-V221)
Accession # Q18PI6-1
10*His
C-term
Protein Length

Extracellular Domain

Synonyms
CD84; SLAM family member 5; SLAMF5
AA Sequence

KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

Molecular Weight

32-37 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD84/SLAMF5 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73506A
Quantity:
MCE Japan Authorized Agent: