1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TAPA-1/CD81
  5. CD81 Protein, Human (His-SUMO)

The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (His-SUMO) is the recombinant human-derived CD81 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (His-SUMO) is the recombinant human-derived CD81 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

CD19 receptor plays a crucial role in the trafficking and compartmentalization of activated B cells. It allows the assembly of CD19-CR2/CD21 and B cell receptor (BCR) complexes at signaling TERMs, leading to a lower threshold dose of antigen required to trigger B cell clonal expansion and antibody production. This receptor also facilitates the localization of CD247/CD3 zeta at antigen-induced synapses with B cells in T cells, providing costimulation and polarization toward T helper type 2 phenotype. Additionally, CD19 is present in MHC class II compartments and may play a role in antigen presentation. It can act as both a positive and negative regulator of cell-cell fusion processes. CD19 positively regulates sperm-egg fusion and may be involved in the acrosome reaction. In myoblasts, it associates with CD9 and PTGFRN to inhibit myotube fusion during muscle regeneration. In macrophages, CD19 associates with CD9 and beta-1 and beta-2 integrins to prevent macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. It also prevents the fusion of mononuclear cell progenitors into osteoclasts responsible for bone resorption. CD19 may also regulate the compartmentalization of enzymatic activities. In T cells, it defines the subcellular localization of dNTPase SAMHD1 and permits its degradation by the proteasome, thereby controlling intracellular dNTP levels. CD19 is also involved in cell adhesion and motility, positively regulating integrin-mediated adhesion of macrophages, particularly in the inflammatory response in the lung. Additionally, CD19 acts as a receptor for hepatitis C virus (HCV) in hepatocytes, in association with CLDN1 and the CLDN1-CD81 receptor complex, essential for HCV entry into host cells.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P60033 (F113-K201)

Gene ID

975  [NCBI]

Molecular Construction
N-term
6*His-SUMO
CD81 (F113-K201)
Accession # P60033
C-term
Synonyms
26 kDa cell surface protein TAPA 1; 26 kDa cell surface protein TAPA-1; 26 kDa cell surface protein TAPA1; CD 81; CD81; CD81 antigen target of antiproliferative 1; ; CD81 antigen; CD81 molecule; CD81_HUMAN; CVID6; S5.7; TAPA 1; TAPA1; Target of the antiproliferative 1; Tetraspanin 28; Tetraspanin-28; Tetraspanin28; Tspan 28; Tspan-28; Tspan28
AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Molecular Weight

Approximately 25.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD81 Protein, Human (His-SUMO)
Cat. No.:
HY-P72126
Quantity:
MCE Japan Authorized Agent: