1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins
  4. Ig-alpha/CD79a
  5. CD79 Protein, Cynomolgus (HEK293, His)

CD79 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD79 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD79 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD79 protein, expressed by HEK293, with C-His tag.

Background

CD79A, in collaboration with CD79B, plays a pivotal role in initiating the signal transduction cascade triggered by antigen binding to the B-cell antigen receptor complex (BCR), resulting in the internalization of the complex, trafficking to late endosomes, and subsequent antigen presentation. This indispensable protein is also crucial for BCR surface expression and the efficient differentiation of pro- and pre-B-cells. CD79A not only stimulates SYK autophosphorylation and activation but also binds to BLNK, facilitating the proximity of BLNK to SYK and enabling the phosphorylation of BLNK. Additionally, it interacts with and enhances the activity of specific Src-family tyrosine kinases, including FYN and LYN. In the context of immature B-cell development, CD79A functions to repress BCR signaling. As a heterodimer of alpha and beta chains, CD79A forms a disulfide-linked complex within the B-cell antigen receptor, where the alpha/beta chain heterodimer non-covalently associates with an antigen-specific membrane-bound surface immunoglobulin composed of two heavy chains and two light chains. The interaction through its phosphorylated ITAM domain with the SH2 domains of SYK stimulates SYK autophosphorylation and activation. Furthermore, when phosphorylated on Tyr-204, CD79A interacts with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and facilitating the phosphorylation of BLNK, a critical step for the trafficking of the BCR to late endosomes. CD79A's versatile interactions contribute to the intricate regulation of B-cell signaling and function.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

XP_045235481.1 (L33-R142)

Gene ID

102123895

Molecular Construction
N-term
CD79 (L33-R142)
Accession # XP_045235481.1
8*His
C-term
Protein Length

Partial

Synonyms
B-cell antigen receptor complex-associated protein; CD79a; IGA; MB1; CD79b; IGB
AA Sequence

LWVDGGPTSLMVSLGEEAHFQCLHNGSNANVTWWRVLHGNYTWPPQFVGKGQGYNGTLTIQNVNKSHGGIYLCRVQEGNKPHQQSCGTYLRVRHPPPRPFLDMGETKNR

Predicted Molecular Mass
13.9 kDa
Molecular Weight

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

Greater than 95% as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD79 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD79 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P704142
Quantity:
MCE Japan Authorized Agent: