1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD7 NK Cell CD Proteins Macrophage CD Proteins
  4. CD7 Protein, Mouse (HEK293, His)

CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The functional role of CD7 protein is currently not fully elucidated, and its specific cellular activities remain unknown. However, it has been identified to interact with SECTM1, suggesting potential involvement in cellular processes mediated by this interaction. Further research is required to comprehensively understand the functional significance and biological activities associated with CD7 protein in cellular contexts.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P50283 (Q24-P150)

Gene ID
Molecular Construction
N-term
CD7 (Q24-P150)
Accession # P50283
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
T-Cell Antigen CD7; GP40; TP41; CD7
AA Sequence

QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP

Molecular Weight

18-30 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72712
Quantity:
MCE Japan Authorized Agent: