1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD7 NK Cell CD Proteins Macrophage CD Proteins
  4. CD7 Protein, Cynomolgus (HEK293, His)

CD7 Protein is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. CD7 plays a vital role in T and NK cell functions after binding to its ligands (K12 protein and galectin-1). CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development. CD7 is also invovled in T and NK cell activation and/or adhesion. CD7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD7 Protein is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. CD7 plays a vital role in T and NK cell functions after binding to its ligands (K12 protein and galectin-1). CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development. CD7 is also invovled in T and NK cell activation and/or adhesion[1][2][4]. CD7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD7, also known as GP40. CD7 is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. Besides, CD7 is also highly expressed in patients with various T cell derived malignancies, such as T-acute lymphoblastic leukemia (T-ALL), T cell lymphoblastic lymphoma (T-LBL), and acute myeloid leukemia (AML)[1].
CD7 has two ligands, K12 protein and galectin-1. CD7 plays a vital role in T and NK cell functions after binding to its ligands[1]. In addition, CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development[2]. It has been also reported that CD7 is involved in both HIV 1 infection and syncytia formation. In mice, CD7 is a key molecule in the lipopolysaccharide-induced inflammatory response[3]. Human CD7 shares about 50% aa sequence identity with mouse.
In conclusion, CD7 is mainly expressed on T and NK cells, and is invovled in T and NK cell activation and/or adhesion[4].

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

A0A2K5VA16 (A26-P180)

Gene ID
Molecular Construction
N-term
CD7 (A26-P180)
Accession # A0A2K5VA16
6*His
C-term
Protein Length

Partial

Synonyms
rCynIg-like domain-containing protein/CD7, His; T-Cell Antigen CD7; GP40; T-Cell Leukemia Antigen; T-Cell Surface Antigen Leu-9; TP41; CD7
AA Sequence

AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALP

Molecular Weight

Approximately 32.0-34.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD7 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD7 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P7808
Quantity:
MCE Japan Authorized Agent: