1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD68
  5. CD68 Protein, Rat (HEK293, His)

CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD68 is a protein that belongs to the LAMP (lysosome-associated membrane protein) family. It is primarily expressed in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 is localized to the lysosomes, which are cellular organelles responsible for the degradation of various molecules. As a lysosomal protein, CD68 plays a crucial role in the processing and presentation of antigens by macrophages and dendritic cells. It is involved in phagocytosis, the process by which these immune cells engulf and digest foreign particles, such as bacteria and cellular debris. CD68 is also implicated in inflammation and tissue remodeling, as its expression can be upregulated in response to inflammatory stimuli. Furthermore, CD68 has been identified as a potential biomarker in certain diseases, including cancer, where its expression is associated with tumor progression and poor prognosis. Understanding the functions and implications of CD68 could provide valuable insights into immune responses and disease pathogenesis.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q4FZY1 (K20-S295)

Gene ID
Molecular Construction
N-term
CD68 (K20-S295)
Accession # Q4FZY1
His
C-term
Protein Length

Partial

Synonyms
CD68 antigenmacrophage antigen CD68; CD68; Gp110; Macrosialin; SRD1
AA Sequence

KDCPHKKAATLLPSFTETPTTTGSTASPTTTHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHGNATVSPTTNSPGFSTVGPHPGPPPPSPSPSPSSTGALGNYTWTNGSQPCVQLQAQIQIRILYLTQGGKKAWGLSVLNPNKTKVQGGCDSAHPHLALSFPYGQLTFGFKQDRHQSHSTVYLNYMAVEYNVSFPQAAQWTFSAQNSSLQELQAPLGQSFCCGNTSIVLSPAIHLDLLSLRLQAAQLPDKGHFGPCFSCASDQS

Molecular Weight

Approximately 60-110 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD68 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74276
Quantity:
MCE Japan Authorized Agent: