1. Recombinant Proteins
  2. CD Antigens Complement System
  3. NK Cell CD Proteins Stem Cell CD Proteins Erythrocyte CD Proteins Complement Regulatory Proteins
  4. CD59
  5. CD59 Protein, Human (P.pastoris, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (P.pastoris, His) is the recombinant human-derived CD59 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (P.pastoris, His) is the recombinant human-derived CD59 protein, expressed by P. pastoris , with N-His labeled tag.

Background

CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) action. It functions by binding to the assembling MAC's C8 and/or C9 complements, thereby impeding the incorporation of multiple copies of C9 necessary for the formation of the osmolytic pore. Notably, this inhibitor exhibits species-specificity. Additionally, CD59 is involved in T-cell activation complexed with a protein tyrosine kinase for signal transduction. It is worth noting that while the soluble form of CD59 from urine retains its specific complement binding activity, it demonstrates a significantly reduced ability to inhibit MAC assembly on cell membranes.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

P13987-1 (L26-N102)

Gene ID

966  [NCBI]

Molecular Construction
N-term
His
CD59 (L26-N102)
Accession # P13987-1
C-term
Synonyms
1F5 ; 1F5 antigen; Human leukocyte antigen MIC11; Ly 6 like protein; MAC-IP; MACIF; MACIP; MEM43; MEM43 antigen
AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Weight

Approximately 11.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD59 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71724
Quantity:
MCE Japan Authorized Agent: