1. Recombinant Proteins
  2. CD Antigens Complement System
  3. Platelet CD Proteins Erythrocyte CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Complement Regulatory Proteins
  4. DAF Protein/CD55 DAF Protein/CD55
  5. CD55/DAF Protein, Human (HEK293, His)

The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, His) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, His) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD55/DAF Protein plays a crucial role in the immune system by recognizing C4b and C3b fragments generated during C4 and C3 activation. Its interaction with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. This interference serves as a regulatory mechanism, inhibiting complement activation and preventing the formation of C3 and C5 convertases, thereby mitigating complement-induced damage. Notably, CD55/DAF also acts as a receptor for Coxsackievirus A21, as well as coxsackieviruses B1, B3, and B5 during microbial infection, highlighting its diverse roles in immune regulation and viral recognition.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P08174 (D35-S353)

Gene ID
Molecular Construction
N-term
DAF (D35-S353)
Accession # P08174
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Complement Decay-Accelerating factor; CD55; CR; DAF
AA Sequence

DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS

Molecular Weight

50-75 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD55/DAF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD55/DAF Protein, Human (HEK293, His)
Cat. No.:
HY-P72721
Quantity:
MCE Japan Authorized Agent: