CD5 Protein, Rhesus Macaque (HEK293, His-Avi)

CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The CD5 protein is distinguished by its deficiency in conserved residue(s) crucial for the propagation of feature annotation.

Immobilized Rhesus macaque CD5 at 1 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-CD5 Antibody with the EC₅₀ of ≤ 8.71 ng/mL determined by ELISA.

Rhesus Macaque

HEK293

C-Avi;C-8*His

F6V5Q9 (R25-P375)

/

Partial

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

55-60 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.