1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins
  4. CD43
  5. CD43 Protein, Mouse (HEK293, Fc)

CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD43 protein in mice emerges as the predominant cell surface sialoprotein of leukocytes, wielding a regulatory influence over various T-cell functions crucial to immune responses. CD43 positively regulates T-cell activation, proliferation, differentiation, trafficking, and migration, particularly enhancing T-cell trafficking to lymph nodes through its interaction with ERM proteins (EZR, RDX, and MSN). In addition to negatively regulating Th2 cell differentiation, CD43 steers T-cells towards a Th1 lineage commitment. It plays a pivotal role in inducing the expression of IFN-gamma during T-cell receptor (TCR) activation, affecting both CD4(+) and CD8(+) T-cells, and contributes to T-cell preparation for cytokine sensing and differentiation into effector cells by influencing the expression of cytokine receptors IFNGR and IL4R. Serving as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and subsequent recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 acts as a T-cell counter-receptor for SIGLEC1 and exhibits a protective role by shielding cells from apoptotic signals, thus promoting cell survival.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P15702 (D20-G248)

Gene ID
Molecular Construction
N-term
CD43 (D20-G248)
Accession # P15702
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Leukosialin; Ly-48; Sialophorin; CD43; CD43ct; SPN
AA Sequence

DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG

Molecular Weight

72-120 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD43 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75404
Quantity:
MCE Japan Authorized Agent: