1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins
  4. CD42c/GP-Ib beta
  5. CD42c/GP1BB Protein, Rat (HEK293, Fc)

The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD42c, a surface membrane protein on platelets, actively contributes to the assembly of platelet plugs by engaging with von Willebrand factor (vWF), which is pre-bound to the subendothelium. This protein complex comprises two GP-Ib beta subunits disulfide-linked to one GP-Ib alpha subunit, forming the GP-Ib heterodimer. Additionally, GP-IX is intricately associated with the GP-Ib heterodimer through a non-covalent linkage, enhancing the structural integrity and functionality of this platelet surface receptor. In molecular interactions, CD42c shows similarity to its association with tumor necrosis factor receptor-associated factor 4 (TRAF4), contributing to the regulatory network governing platelet function.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q9JJM7 (P27-C147)

Gene ID
Molecular Construction
N-term
CD42c (P27-C147)
Accession # Q9JJM7
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Platelet glycoprotein Ib beta chain; GP-Ib beta; GP1BB
AA Sequence

PAPCRCSETRVDCGRRGLTWASLPAAFPPDTTELVLTDNNLTALPPGLLDTLPALRRVHLGANPWRCDCRLLPLRAWLAGRPEREFYRDLRCVAPLALRGRLLPYVAEDELRAACAPGLLC

Molecular Weight

Approximately 45-55 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD42c/GP1BB Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD42c/GP1BB Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P77323
Quantity:
MCE Japan Authorized Agent: