1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Human (HEK293, Fc)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (HEK293, Fc) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (HEK293, Fc) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD40 Protein, acting as the receptor for TNFSF5/CD40LG, is instrumental in transducing signals through TRAF6- and MAP3K8-mediated pathways, leading to the activation of ERK in macrophages and B cells and subsequent induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein exhibits variations in its homodimeric structure, as observed in the bladder carcinoma cell line Hu549. The receptor interacts with key signaling molecules such as TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, with the crucial interaction occurring between CD40 Protein, TRAF6, and MAP3K8, thereby playing a pivotal role in ERK activation.

Biological Activity

Immobilized human CD40L-His at 10 μg/mL (100 μL/well) can bind Human CD40-Fc. The EC50 of Human CD40-Fc is 10-30 ng/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P25942-1 (E21-R193)

Gene ID

958  [NCBI]

Molecular Construction
N-term
CD40 (E21-R193)
Accession # P25942-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor Necrosis Factor Receptor Superfamily member 5; Bp50; CD40L Receptor; CDw40; TNFRSF5
AA Sequence

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Weight

Approximately 54.1 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72910
Quantity:
MCE Japan Authorized Agent: