1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Cynomolgus (HEK293, His)

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD40, a crucial member of the TNFR superfamily, is characterized by the absence of conserved residue(s) necessary for the propagation of feature annotation. This distinctive feature suggests unique structural attributes in CD40, potentially influencing its functional interactions within the TNFR superfamily. The lack of these conserved residues underscores the specific nature of CD40 and emphasizes the importance of further exploration to unravel its distinct roles and regulatory mechanisms in cellular signaling pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 60.12 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 60.12 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

G7PG38 (E21-R193)

Gene ID
Molecular Construction
N-term
CD40 (E21-R193)
Accession # G7PG38
6*His
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 5; Bp50; CD40; TNFRSF5
AA Sequence

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLQVQQKGTSETDTICTCEEGLHCTSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

Molecular Weight

28-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72725
Quantity:
MCE Japan Authorized Agent: