1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD4 T Cell CD Proteins Dendritic Cell CD Proteins
  4. CD4 Protein, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD4 protein, an integral membrane glycoprotein, assumes a crucial role in immune responses, undertaking diverse functions against both external and internal challenges. In T-cells, its primary function is as a coreceptor for the MHC class II molecule:peptide complex, where class II peptides originate from extracellular proteins, while class I peptides are derived from cytosolic proteins. CD4 interacts concurrently with the T-cell receptor (TCR) and the MHC class II presented by antigen-presenting cells (APCs), leading to the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. Subsequently, LCK initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately resulting in lymphokine production, enhanced motility, adhesion, and the activation of T-helper cells. In other cell types such as macrophages or NK cells, CD4 contributes to differentiation/activation, cytokine expression, and cell migration through a TCR/LCK-independent pathway. Additionally, it plays a pivotal role in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages. Notably, CD4 acts as the primary receptor for human immunodeficiency virus-1 (HIV-1), with its down-regulation facilitated by HIV-1 Vpu, and it also serves as a receptor for Human Herpes virus 7/HHV-7[1][2][3].

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. When 5×104 cells/well are added to CD4-coated plates (1.25μg/mL and 100μL/well), approximately 53.82% will adhere specifically after 30 minutes at 37°C.

Species

Others

Source

HEK293

Tag

C-His

Accession

I6LI22 (R26-L401)

Gene ID

101684487  [NCBI]

Molecular Construction
N-term
CD4 (R26-L401)
Accession # I6LI22
His
C-term
Protein Length

Partial

Synonyms
T-cell surface glycoprotein CD4; T-cell surface antigen T4/Leu-3; CD4
AA Sequence

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Weight

Approximately 52 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD4 Protein, Ferret (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD4 Protein, Ferret (HEK293, His)
Cat. No.:
HY-P72900
Quantity:
MCE Japan Authorized Agent: