1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. CD3E-CD3G Heterodimer Proteins
  5. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc)

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P75414
Handling Instructions Technical Support

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Background

The CD3E protein, predicted to possess various functions such as SH3 domain binding activity, identical protein binding activity, and protein heterodimerization activity, plays a crucial role in nervous system development and the positive regulation of cell adhesion. It is actively involved upstream of multiple processes, including positive regulation of T cell activation, positive regulation of cytokine production, and regulation of signal transduction. The protein is located in diverse cellular components, including dendritic spines, the external side of the plasma membrane, and immunological synapses. As part of the alpha-beta T cell receptor complex, its expression is observed in the colon and hemolymphoid system. The human ortholog of this gene, CD3E, has implications in immunodeficiency 18, highlighting its significance in immune system functionality. Biased expression is evident in tissues such as the thymus and spleen, underscoring its role in immune processes.

Biological Activity

Immobilized Human CD3E-CD3G at 2 μg/mL (100 μL/well) can bind Anti-CD3 Antibody. The ED50 for this effect is 1.792 ng/mL.

  • Immobilized Human CD3E-CD3G at 2 μg/mL (100 μL/well) can bind Anti-CD3 Antibody, The ED50 for this effect is 1.792ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

NP_031674.1 (D23-D108)&NP_033980.1 (Q23-S116)

Gene ID
Synonyms
AI504783 Protein; CD3 Protein; CD3epsilon Protein; T3e Protein
AA Sequence

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
&:
QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Weight

Approximately 38-40 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75414
Quantity:
MCE Japan Authorized Agent: