1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. CD3D-CD3E Heterodimer Proteins
  5. CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His)

CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His)

Cat. No.: HY-P70434
Handling Instructions Technical Support

CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His) is a recombinant protein dimer complex containing human-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-hFc, C-Flag, C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His), has molecular weight of 40-52 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His) is a recombinant protein dimer complex containing human-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-hFc, C-Flag, C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His), has molecular weight of 40-52 kDa.

Background

CD3D Protein, an integral part of the TCR-CD3 complex on the surface of T-lymphocytes, plays a pivotal role in the adaptive immune response. Activated by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals through the CD3 chains CD3D, CD3E, CD3G, and CD3Z, which harbor immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these ITAMs are phosphorylated by Src family protein tyrosine kinases LCK and FYN, activating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3D is indispensable for thymocyte differentiation, contributing to the correct intracellular assembly and surface expression of the TCR-CD3 complex. Thymocytes lacking a functional TCR-CD3 complex face impaired differentiation. CD3D also interacts with coreceptors CD4 and CD8, establishing a functional link between the TCR and coreceptors crucial for the activation and positive selection of CD4 or CD8 T-cells. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers that, in turn, interact with CD3Z homodimers to complete the hexameric TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be substituted by TCRgamma and TCRdelta. These intricate interactions highlight CD3D's multifaceted role in orchestrating T-cell responses.

Biological Activity

Measured by its ability to bind OKT3-mIgG2a in a functional ELISA. The ED50 for this effect is 11.31 ng/mL.

  • Measured by its ability to bind OKT3-mIgG2a in a functional ELISA.The ED50 for this effect is 11.31 ng/mL.
Species

Human

Source

HEK293

Tag

C-hFc;C-Flag;C-6*His

Accession

P04234 (F22-A105)&P07766 (D23-D126)

Gene ID

915  [NCBI]&916  [NCBI]

Molecular Construction
N-term
CD3D (F22-A105)
Accession # P04234
hFc-Flag
C-term
N-term
CD3E (D23-D126)
Accession # P07766
hFc-6*His
C-term
Synonyms
CD3E & CD3D; CD3 delta & CD3 epsilon; CD3 delta /epsilon
AA Sequence

FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
&:
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Weight

40-52 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3D-CD3E Heterodimer Protein, Human (HEK293, Fc-Flag&Fc-His)
Cat. No.:
HY-P70434
Quantity:
MCE Japan Authorized Agent: