1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Stem Cell CD Proteins
  4. CD38
  5. CD38 Protein, Rat (HEK293, Fc)

CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD38 protein performs multiple essential functions. It is responsible for synthesizing two crucial second messengers, cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate. Cyclic ADP-ribose acts as a second messenger for glucose-induced insulin secretion, while nicotinate-adenine dinucleotide phosphate functions as a calcium mobilizer. CD38 also possesses cADPR hydrolase activity, adding to its functional repertoire. Additionally, CD38 regulates osteoclastic bone resorption, most likely through the production of cyclic ADP-ribose and the initiation of a calcium ion signal via activation of the ryanodine receptor.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q64244 (W45-V303)

Gene ID
Molecular Construction
N-term
CD38 (W45-V303)
Accession # Q64244
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; 2'-phospho-ADP-ribosyl cyclase; ADPRC 1; CD38
AA Sequence

WPRSPLVWKGKPTTKHFADIILGRCLIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSEPFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSCRLNV

Predicted Molecular Mass
56.7 kDa
Molecular Weight

Approximately 67 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD38 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P72897
Quantity:
MCE Japan Authorized Agent: