1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins
  4. CD37/Tspan-26
  5. CD37 Protein, Mouse (HEK293, hFc)

The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD37 is used at 10 μg/mL can bind Recombinant Mouse CD19. The ED50 for this effect is 4.604 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD37 is used at 10 μg/mL can bind Recombinant Mouse CD19. The ED50 for this effect is 4.604 μg/mL.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q61470 (R112-N241)

Gene ID
Molecular Construction
N-term
hFc
CD37 (R112-N241)
Accession # Q61470
C-term
Protein Length

Partial

Synonyms
Leukocyte antigen CD37; CD37; TSPAN26
AA Sequence

RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN

Molecular Weight

Approximately 50-60 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD37 Protein, Mouse (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD37 Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P75418
Quantity:
MCE Japan Authorized Agent: