1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CD367/CLEC4A
  6. CD367/CLEC4A Protein, Mouse (Myc, His-SUMO)

CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

The CD367/CLEC4A protein potentially plays a role in regulating immune reactivity and may have implications in modulating the differentiation and maturation of dendritic cells (DC). It is a C-type lectin receptor that can bind to carbohydrates such as mannose and fucose, as well as weakly interact with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. CD367/CLEC4A is involved in inhibiting B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Upon antigen stimulation, it undergoes clathrin-dependent endocytosis, delivering its antigenic cargo into the antigen presentation pathway and promoting cross-priming of CD8(+) T cells. This cross-presentation and cross-priming process can be enhanced by TLR7 and TLR8 agonists, resulting in increased expansion of CD8(+) T cells and high production of IFNG and TNF, while reducing levels of IL4, IL5, and IL13. In plasmacytoid dendritic cells, CD367/CLEC4A inhibits TLR9-mediated production of IFNA and TNF. Furthermore, its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) may contribute to the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

Q9QZ15 (Q70-L238)

Gene ID
Molecular Construction
N-term
10*His-SUMO
CLEC4A (Q70-L238)
Accession # Q9QZ15
C-term
Protein Length

Extracellular Domain

Synonyms
Clec4a; Clec4a2; Clecsf6; DcirC-type lectin domain family 4 member A; C-type lectin superfamily member 6; Dendritic cell immunoreceptor; CD antigen CD367
AA Sequence

QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Predicted Molecular Mass
39.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD367/CLEC4A Protein, Mouse (Myc, His-SUMO)
Cat. No.:
HY-P71636
Quantity:
MCE Japan Authorized Agent: