1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Siglec
  4. Siglec-3/CD33 Siglec-3/CD33
  5. Siglec-3/CD33 Protein, Human (HEK293, Fc-Myc)

Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-Myc, C-Fc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-Myc, C-Fc labeled tag.

Background

The Siglec-3/CD33 protein, a sialic-acid-binding immunoglobulin-like lectin, plays a crucial role in mediating cell-cell interactions and maintaining immune cells in a resting state. It exhibits a preference for recognizing and binding alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement with ligands like C1q or sialylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) within CD33's cytoplasmic tail undergo phosphorylation by Src-like kinases such as LCK. These phosphorylated ITIMs serve as docking sites for recruiting and activating protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, which, in turn, regulate downstream pathways through dephosphorylation of signaling molecules. CD33's repressive effect on monocyte activation involves phosphoinositide 3-kinase/PI3K. Structurally, the protein forms homodimers through disulfide linkages and interacts with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. It also engages with C1QA via its C-terminus, activating CD33 inhibitory motifs.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/mL can bind Anti-CD33 rabbit monoclonal antibody and the EC50 of human CD33 protein is 0.4375-0.6651 ng/mL.

Species

Human

Source

HEK293

Tag

C-Myc;C-Fc

Accession

P20138-1 (D18-H259)

Gene ID

945  [NCBI]

Molecular Construction
N-term
CD33 (D18-H259)
Accession # P20138-1
hFc-Myc
C-term
Protein Length

Extracellular Domain

Synonyms
Sialic acid-binding Ig-like lectin 3 Siglec-3; gp67; CD33; SIGLEC3;
AA Sequence

DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Molecular Weight

Approximately 92 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Siglec-3/CD33 Protein, Human (HEK293, Fc-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-3/CD33 Protein, Human (HEK293, Fc-Myc)
Cat. No.:
HY-P72021
Quantity:
MCE Japan Authorized Agent: