Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His)

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and is involved in a variety of effector and regulatory functions. When co-aggregated with BCR, TCR and Fc receptors, it promotes endocytosis of soluble immune complexes (IIB2), modulates antibody production, and downregulates B-cell, T-cell and mast cell activation. Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.

Fc gamma RIIB/CD32b Protein functions as a receptor for the Fc region of complexed immunoglobulins gamma, exhibiting low affinity. It plays a role in various effector and regulatory functions, including the phagocytosis of antigen-antibody complexes from the circulation and the modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but do not mediate endocytosis or phagocytosis, while isoform IIB2 can facilitate the endocytosis of soluble immune complexes via clathrin-coated pits. Both isoform IIB1 and isoform IIB2 can down-regulate the activation of B-cells, T-cells, and mast cells when coaggregated with B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively. Fc gamma RIIB/CD32b interacts with FGR and LYN (By similarity).

Loaded Recombinant Mouse CD32b on HIS1K Biosensor, can bind Recombinant Mouse IgG1 Fc with an affinity constant of 64.9 nM as determined in BLI assay.

Mouse

HEK293

C-6*His

P08101-1 (T30-P210)

14130  [NCBI]

Extracellular Domain

THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP

Approximately 31 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.