1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. CD3ζ
  5. CD3 zeta/CD247 Protein, Human (His)

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (GST) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (GST) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-GST labeled tag.

Background

CD3 zeta/CD247, an integral component of the TCR-CD3 complex on the T-lymphocyte cell surface, plays a crucial role in adaptive immune responses. When activated by antigen-presenting cells (APCs), the T-cell receptor (TCR)-mediated signals are transmitted across the cell membrane through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z. These chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which, upon TCR engagement, become phosphorylated by Src family protein tyrosine kinases LCK and FYN. The phosphorylation of CD3Z ITAMs creates multiple docking sites for the protein kinase ZAP70, leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Beyond its role in signal transduction, CD3Z is essential for intrathymic T-cell differentiation and contributes to the activity-dependent synapse formation of retinal ganglion cells (RGCs) in the retina and dorsal lateral geniculate nucleus (dLGN). The TCR-CD3 complex, comprising heterodimers CD3D/CD3E and CD3G/CD3E, associates preferentially with TCRalpha and TCRbeta, forming trimers. The hexamer interacts with CD3Z homodimers to complete the TCR-CD3 complex, demonstrating its versatility in TCR assembly. Additionally, CD3Z interacts with various proteins, such as SLA, TRAT1, DOCK2, SHB, ZAP70, and others, contributing to its multifaceted functions in immune responses and cellular interactions.

Biological Activity

Measured by its ability to inhibit the cell growth of Jurkat cells. The ED50 for this effect is 198.5 ng/mL, corresponding to a specific activity is 5.038×103 units/mg.

  • Measured by its ability to inhibit the cell growth of Jurkat cells. The ED50 for this effect is 198.5 ng/ml, corresponding to a specific activity is 5.038×103 units/mg.
Species

Human

Source

E. coli

Tag

N-His

Accession

P20963-1 (R52-R164)

Gene ID

919  [NCBI]

Molecular Construction
N-term
GST
CD3Z (R52-R164)
Accession # P20963
C-term
Protein Length

Cytoplasmic Domain

Synonyms
T-cell surface glycoprotein CD3 zeta chain; CD247; CD3Z; T3Z; TCRZ
AA Sequence

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD3 zeta/CD247 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 zeta/CD247 Protein, Human (His)
Cat. No.:
HY-P76220
Quantity:
MCE Japan Authorized Agent: