1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins
  4. CD3g
  5. CD3 gamma Protein, Cynomolgus (P.pastoris, His)

CD3 gamma Protein, Cynomolgus (P.pastoris, His)

Cat. No.: HY-P71845
Handling Instructions Technical Support

CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.

Background

CD3 gamma Protein is an integral part of the TCR-CD3 complex found on the surface of T-lymphocytes, playing a crucial role in adaptive immune response. When T-cell receptors (TCRs) on antigen presenting cells (APCs) are activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals across the cell membrane. Each CD3 chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which are phosphorylated by LCK and FYN protein tyrosine kinases upon TCR engagement, leading to downstream signaling activation. Apart from signal transduction, CD3G also plays a vital role in regulating TCR expression at the cell surface, particularly through the di-leucine-based (diL) receptor-sorting motif present in CD3G that influences constitutive TCR cycling. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. These trimers then interact with CD3Z homodimer to form the complete TCR-CD3 complex. Alternatively, TCRgamma and TCRdelta can replace TCRalpha and TCRbeta in this complex.

Species

Cynomolgus

Source

P. pastoris

Tag

N-His

Accession

Q95LI7 (Q23-T113)

Gene ID
Molecular Construction
N-term
His
CD3 gamma (Q23-T113)
Accession # Q95LI7
C-term
Protein Length

Extracellular Domain

Synonyms
CD3GT-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD antigen CD3g
AA Sequence

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Predicted Molecular Mass
12.5 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD3 gamma Protein, Cynomolgus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 gamma Protein, Cynomolgus (P.pastoris, His)
Cat. No.:
HY-P71845
Quantity:
MCE Japan Authorized Agent: