1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD3e
  5. CD3 epsilon Protein, Cynomolgus (HEK293, Fc)

The CD3E/CD3 epsilon 1-27 peptide is critical in the TCR-CD3 complex, transmitting signals during T cell activation. When APC activates the TCR, CD3E undergoes LCK/FYN-mediated phosphorylation together with ITAM, initiating downstream signaling. CD3 epsilon Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 epsilon protein, expressed by HEK293 , with C-Fc, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD3E/CD3 epsilon 1-27 peptide is critical in the TCR-CD3 complex, transmitting signals during T cell activation. When APC activates the TCR, CD3E undergoes LCK/FYN-mediated phosphorylation together with ITAM, initiating downstream signaling. CD3 epsilon Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 epsilon protein, expressed by HEK293 , with C-Fc, C-hFc labeled tag.

Background

The CD3E/CD3 epsilon 1-27 peptide, integral to the TCR-CD3 complex on T-lymphocyte cell surfaces, plays a crucial role in adaptive immune responses. Upon activation by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals across the cell membrane through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z, each containing immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domains. Phosphorylation of these ITAMs by Src family protein tyrosine kinases LCK and FYN, upon TCR engagement, activates downstream signaling pathways. Beyond its role in signal transduction, CD3E is indispensable for correct T-cell development, initiating the assembly of the TCR-CD3 complex by forming heterodimers CD3D/CD3E and CD3G/CD3E. Additionally, CD3E participates in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences in its cytosolic region. The TCR-CD3 complex, comprising CD3D/CD3E and CD3G/CD3E heterodimers, preferentially associates with TCRalpha and TCRbeta, forming trimers. This hexamer then interacts with CD3Z homodimers to complete the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. The CD3E/CD3 epsilon 1-27 peptide also interacts with CD6, NCK1, and NUMB, with the NUMB interaction being crucial for TCR-CD3 internalization and subsequent degradation.

Biological Activity

Monoclonal Anti-Human CD3 Antibody, Mouse IgG1 captured on CM5 chip via anti-mouse antibodies surface can bind CD3 epsilon, with an affinity constant of 0.3171 nM as determined in a SPR assay.

  • Monoclonal Anti-Human CD3 Antibody, Mouse IgG1 captured on CM5 chip via anti-mouse antibodies surface can bind CD3 epsilon, with an affinity constant of 0.3171 nM as determined in a SPR assay.
Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

Q95LI5 (Q22-D117)

Gene ID
Molecular Construction
N-term
CD3 epsilon (Q22-D117)
Accession # Q95LI5
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
rCynT-cell surface glycoprotein CD3 epsilon chain/CD3E, Fc ; CD3 epsilon; CD3e antigen; CD3e antigen, epsilon polypeptide (TiT3 complex); CD3e molecule, epsilon (CD3-TCR complex); CD3e; CD3-epsilon; FLJ18683; T3E; T-cell antigen receptor complex, epsilon subunit of T3; T-cell surface antigen T3/Leu-4 epsilon chain;
AA Sequence

QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

Molecular Weight

38-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 100 mM Glycine, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 epsilon Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P70090
Quantity:
MCE Japan Authorized Agent: