1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD3e
  5. CD3 epsilon Protein, Canine (HEK293, Fc)

The CD3 ε protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When APC is activated, TCR signals transmitted by CD3D, CD3E, CD3G, and CD3Z initiate pathways through ITAM. CD3 epsilon Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD3 ε protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When APC is activated, TCR signals transmitted by CD3D, CD3E, CD3G, and CD3Z initiate pathways through ITAM. CD3 epsilon Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD3 epsilon protein is an integral component of the TCR-CD3 complex located on the T-lymphocyte cell surface, playing a pivotal role in adaptive immune responses. When activated by antigen-presenting cells (APCs), the T-cell receptor (TCR) initiates signaling pathways transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G, and CD3Z, all of which contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these ITAMs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, activating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3E is indispensable for proper T-cell development and plays a crucial role in initiating TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. CD3E also participates in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences present in its cytosolic region. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers that associate with TCRalpha and TCRbeta, forming trimers. The hexamer interacts with CD3Z homodimer to complete the TCR-CD3 complex, with the flexibility for TCRalpha and TCRbeta substitution by TCRgamma and TCRdelta. CD3E further interacts with CD6, NCK1, and NUMB, the latter being crucial for TCR-CD3 internalization and subsequent degradation. This intricate network underscores the multifunctional role of CD3E in orchestrating T-cell responses.

Biological Activity

Immobilized CD3 epsilon Protein at 1 μg/mL (100 μL/well) can bind anti-CD3, The ED50 for this effect is 1.323 ng/mL.

  • Immobilized CD3 epsilon Protein at 1 μg/mL (100 μL/well) can bind anti-CD3, The ED50 for this effect is 1.323 ng/mL.
Species

Canine

Source

HEK293

Tag

C-hFc

Accession

P27597 (Q22-L122)

Gene ID
Molecular Construction
N-term
CD3 epsilon (Q22-L122)
Accession # P27597
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
T-Cell Surface Glycoprotein CD3 Epsilon Chain; T-Cell Surface Antigen T3/Leu-4 Epsilon Chain; CD3e; CD3E; T3E
AA Sequence

QDEDFKASDDLTSISPEKRFKVSISGTEVVVTCPDVFGYDNIKWEKNDNLVEGASNRELSQKEFSEVDDSGYYACYADSIKEKSYLYLRARVCANCIEVNL

Molecular Weight

Approximately 41-43 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 epsilon Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P77320
Quantity:
MCE Japan Authorized Agent: