1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD28
  5. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc)

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc)

Cat. No.: HY-P7334
Handling Instructions Technical Support

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD28, a T cell costimulatory receptor, is a primary target for PD-1-mediated inhibition.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD28, a T cell costimulatory receptor, is a primary target for PD-1-mediated inhibition.

Background

CD28 is the quintessential costimulatory molecule expressed on CD4+ and CD8+ T cells. During chronic infections and the normal aging process, CD28 expression is lost, compromising the functional activity of T cells. CD28 loss is promoted by replicative stress, particularly in the presence of tumor necrosis factor–α, owing to an inoperative CD28 initiator element. The co-receptor CD28 is strongly preferred over the T cell receptor (TCR) as a target for dephosphorylation by PD-1-recruited Shp2 phosphatase[1].

Biological Activity

1. 2 µg/mL (100 µL/well) of immoblized recombinant human CD28-Fc can bind human Biotin-B7-1(CD80)-Fc with a linear range of 0.01-0.5 μg/mL.
2. Immobilized Anti-CD28 mAb at 2 μg/mL (100 μl/well) can bind Human/Cynomolgus CD28-Fc *: Biotinylated by NHS-biotin prior to testing.The ED50 of Human/Cynomolgus CD28-Fc * is 13.97 ng/mL.
3. Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque CD28 is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human B7-1. The ED50 for this effect is 201.9 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque CD28 is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human B7-1. The ED50 for this effect is 201.9 ng/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P10747-1/Q0PDN3/Q0PDN4 (N19-P152)

Gene ID

940  [NCBI]/705313

Molecular Construction
N-term
CD28 (N19-P152)
Accession # P10747-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
rHuCD28, Fc Chimera; TP44
AA Sequence

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Molecular Weight

66-70 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc)
Cat. No.:
HY-P7334
Quantity:
MCE Japan Authorized Agent: