1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H3 B7-H3/CD276
  5. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc)

CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc)

Cat. No.: HY-P700448
Handling Instructions Technical Support

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.

Background

The CD276/B7-H3 protein is suggested to play a multifaceted role in the regulation of T-cell-mediated immune responses, potentially acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis and serving as a marker for the detection of neuroblastoma cells. Additionally, CD276/B7-H3 may be involved in the development of acute and chronic transplant rejection, contributing to the regulation of lymphocytic activity at mucosal surfaces. Notably, it could play a crucial role in providing the placenta and fetus with an immunologically suitable environment throughout pregnancy. Both isoform 1 and isoform 2 of CD276/B7-H3 appear redundant in their ability to modulate CD4 T-cell responses, with isoform 2 demonstrated to enhance the induction of cytotoxic T-cells and selectively stimulate interferon-gamma production in the presence of T-cell receptor signaling. The interaction with TREML2 is identified as enhancing T-cell activation, highlighting the diverse roles CD276/B7-H3 may play in immune regulation and cellular responses.

Species

Human

Source

HEK293

Tag

C-Myc;C-hFc

Accession

Q5ZPR3-1 (L29-G245)

Gene ID
Molecular Construction
N-term
CD276 (L29-G245)
Accession # Q5ZPR3-1
hFc-Myc
C-term
Protein Length

Partial

Synonyms
CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;
AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Predicted Molecular Mass
53.4 kDa
Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc)
Cat. No.:
HY-P700448
Quantity:
MCE Japan Authorized Agent: