1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. B Cell CD Proteins Platelet CD Proteins Epithelial cell CD Proteins Fc-epsilon Receptor
  4. Fc epsilon RII/CD23
  5. CD23/Fc epsilon RII Protein, Human (HEK293, His)

CD23/Fc epsilon RII Protein, Human (HEK293, His)

Cat. No.: HY-P72748
Handling Instructions Technical Support

CD23 or Fc epsilon receptor II (Fc epsilon RII) is a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). CD23 is present on B cells, regulates IgE production and B cell differentiation, and aids in IgE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Human (HEK293, His) is the recombinant human-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD23 or Fc epsilon receptor II (Fc epsilon RII) is a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). CD23 is present on B cells, regulates IgE production and B cell differentiation, and aids in IgE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Human (HEK293, His) is the recombinant human-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-8*His labeled tag.

Background

CD23, also known as Fc epsilon receptor II (Fc epsilon RII), functions as a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). Playing crucial roles in the regulation of IgE production and B cell differentiation, CD23 on B cells facilitates IgE-dependent antigen uptake and presentation to T cells. In macrophages, IgE binding and antigen cross-linking trigger intracellular killing of parasites by activating the L-Arginine-nitric oxide pathway. CD23 forms homotrimers and interacts with IGHE, specifically via its C-type lectin domain, regulating IgE homeostasis. Furthermore, CD23 interacts with CR2/CD21 through its C-terminus, specifically engaging with Sushi domains 1 and 2 of CR2/CD21. These interactions underscore CD23's multifaceted involvement in immune responses, ranging from B cell activation to the macrophage-mediated defense against parasites.

Species

Human

Source

HEK293

Tag

N-8*His

Accession

P06734 (D48-S321)

Gene ID
Molecular Construction
N-term
8*His
CD23 (D48-S321)
Accession # P06734
C-term
Protein Length

Extracellular Domain

Synonyms
Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; FCER2; CD23A; CLEC4J; FCE2; IGEBF
AA Sequence

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Molecular Weight

35-40 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD23/Fc epsilon RII Protein, Human (HEK293, His)
Cat. No.:
HY-P72748
Quantity:
MCE Japan Authorized Agent: