1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD2
  5. CD2 Protein, Rat (HEK293, Fc)

CD2 Protein, a cell surface glycoprotein, mediates T-cell activation and adhesion by binding to its ligand, CD58. It facilitates immune responses and intercellular communication. CD2 Protein is a promising target for immunotherapy and may lead to innovative treatments for immune-related disorders. CD2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD2 Protein, a cell surface glycoprotein, mediates T-cell activation and adhesion by binding to its ligand, CD58. It facilitates immune responses and intercellular communication. CD2 Protein is a promising target for immunotherapy and may lead to innovative treatments for immune-related disorders. CD2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD2 protein plays a crucial role in facilitating adhesion between T-cells and various cell types through its interactions with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1. It is also involved in triggering T-cells and transmitting signals via its cytoplasmic domain. Additionally, CD2 interacts with CD48, CD58 (LFA-3), CD2AP, and PSTPIP1, suggesting their potential involvement in related cellular processes. Notably, the interaction between CD2 and FCGR3A can modulate NK cell activation and cytotoxicity.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD2, at 2μg/mL (100μL/well) can bind Anti-CD2 antibody. The ED50 for this effect is 1.486 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat CD2, at 2μg/mL (100μL/well) can bind Anti-CD2 antibody. The ED50 for this effect is 1.486 μg/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q5I0M6 (R23-P202)

Gene ID
Molecular Construction
N-term
CD2 (R23-P202)
Accession # Q5I0M6
hFc
C-term
Protein Length

Partial

Synonyms
T-cell surface antigen CD2; LFA-3 receptor; LFA-2; CD2; SRBC
AA Sequence

RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLP

Molecular Weight

Approximately 57-75 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD2 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD2 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74322
Quantity:
MCE Japan Authorized Agent: