1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD19 B Cell CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD19 Protein, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca(2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca(2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD19 protein functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes, effectively reducing the threshold for downstream signaling pathways and initiating B-cell responses to antigens. It activates signaling cascades leading to phosphatidylinositol 3-kinase activation and mobilization of intracellular Ca(2+) stores. While not essential for early B cell differentiation in the bone marrow, CD19 is crucial for the normal differentiation of B-1 cells and plays a vital role in B cell differentiation and proliferation in response to antigen challenges. Furthermore, CD19 is required for maintaining normal levels of serum immunoglobulins and the production of high-affinity antibodies upon antigen exposure. CD19 interacts with CR2/CD21 and forms a complex with CD81, CR2/CD21, CD81, and IFITM1/CD225 in the membrane of mature B-cells. It also interacts directly with CD81, essential for trafficking and compartmentalization of the CD19 receptor on the cell surface when phosphorylated on specific tyrosine residues. Additionally, CD19 interacts with PLCG2 when phosphorylated on Tyr-402 and with LYN, and it forms an interaction with the regulatory p85 subunit of phosphatidylinositol 3-kinase (PI3K) when tyrosine phosphorylated.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD19 is present at 2 μg/mL, can bind Recombinant biotinylated Human CD81. The ED50 for this effect is 8.41 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD19 is present at 2 μg/mL, can bind Recombinant biotinylated Human CD81. The ED50 for this effect is 8.41 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

P25918 (G17-G287)

Gene ID
Molecular Construction
N-term
CD19 (G17-G287)
Accession # P25918
His
C-term
Protein Length

Partial

Synonyms
B-lymphocyte antigen CD19; CD19; B-lymphocyte surface antigen B4
AA Sequence

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5-7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD19 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74328
Quantity:
MCE Japan Authorized Agent: