1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. MUC-24/CD164
  5. CD164 Protein, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34(+) cell adhesion while negatively regulating CD34(+)CD38(lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34(+) cell adhesion while negatively regulating CD34(+)CD38(lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD164 is a sialomucin that potentially holds a pivotal role in hematopoiesis, facilitating the adhesion of CD34(+) cells to the stroma while negatively regulating the proliferation of CD34(+)CD38(lo/-) cells. This protein is implicated in the modulation of umbilical cord blood CD133+ cell migration through the CXCL12/CXCR4 axis. Additionally, CD164 is associated with prostate cancer metastasis and the infiltration of cancer cells into the bone marrow. It exerts a positive influence on myogenesis by enhancing CXCR4-dependent cell motility, promoting myoblast migration, and facilitating myoblast fusion into myotubes. The protein exists as a homodimer (isoform 4) and interacts with CXCR4 in these cellular processes.

Biological Activity

Measured by its ability to chemoattract of PC-3 cells. The ED50 for this effect is 6.165 μg/mL.

  • Measured by its ability to chemoattract of PC-3 cells. The ED50 for this effect is 6.165 μg/mL, corresponding to a specific activity is 162.2 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q04900 (D24-D162)

Gene ID
Molecular Construction
N-term
CD164 (D24-D162)
Accession # Q04900
His
C-term
Protein Length

Extracellular Domain

Synonyms
Sialomucin core protein 24; MUC-24; Endolyn; MGC-24; CD164
AA Sequence

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD164 Protein, Human (HEK293, His)
Cat. No.:
HY-P75617
Quantity:
MCE Japan Authorized Agent: