1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Killer-Cell Immunoglobulin-like Receptors
  4. CD158d/KIR2DL4
  5. CD158d/KIR2DL4 Protein, Human (HEK293, His)

CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential[1][2].

Background

KIR2DL4 is the most distinct gene in the KIR family. KIR2DL4 is composed of D0 and D2 Ig-like domains (D0 is the first Ig-like domain of the KIR3D subfamily). The KIR2DL4 promoter differs substantially from all other KIR genes, and both alleles are expressed in essentially all activated NK cells. KIR2DL4 is constitutively expressed only on the surface of the CD56bright subset of peripheral blood NK cells. KIR2DL4 associates with the FcεRIγ adapter protein, but not with DAP12 and has a functional ITIM in its cytoplasmic domain. Despite the presence of an ITIM, cross-linking KIR2DL4 with mAb induces the production of IFN-γ in resting NK cells and triggers cytotoxicity and IFN-γ production in IL-2-activated NK cells[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

ADY38409.1 (W22-H242)

Gene ID
Molecular Construction
N-term
KIR2DL4 (W22-H242)
Accession # ADY38409.1
6*His
C-term
Synonyms
rHuCD158d, His; Killer Cell Immunoglobulin-Like Receptor 2DL4; CD158 Antigen-Like Family Member D; KIR-103AS; MHC Class I NK Cell Receptor KIR103AS; CD158d; KIR2DL4; KIR103AS
AA Sequence

WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH

Molecular Weight

Approximately 30-40 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD158d/KIR2DL4 Protein, Human (HEK293, His)
Cat. No.:
HY-P7794
Quantity:
MCE Japan Authorized Agent: