CD151 Protein-VLP, Human (HEK293)

CD151 Protein-VLP, Human (HEK293) is the recombinant human-derived CD151 protein, expressed by HEK293, with tag free tag.

CD151 is a structural component of tetraspanin-enriched microdomains (TERMs), serving as platforms for receptor clustering and signaling. Through interactions with both integrin and non-integrin proteins, it participates in various cellular and molecular mechanisms, including cell-to-cell communication, wound healing, platelet aggregation, trafficking, cell motility, and angiogenesis. By associating with JAM-A/F11R and integrin ITGA3:ITGB1, CD151 facilitates the recruitment of signaling molecules such as RAC1, CDC42, and RhoGTPases, promoting epithelial cell polarization and actin cytoskeleton reorganization—critical steps in cell migration. It also regulates the glycosylation pattern of ITGA3:ITGB1 to modulate its activity and plays a vital role in maintaining the stability of central laminin-binding integrin ITGA6:ITGB4-containing adhesion complexes. Furthermore, CD151 is essential for the proper assembly of glomerular and tubular basement membranes in the kidney and enhances T-cell activation by modulating integrin signaling, leading to downstream activation of PTK2 and MAPK1/MAPK3. In microbial infections, CD151 contributes to human papillomavirus 16/HPV-16 endocytosis and facilitates human cytomegalovirus entry into host cells by influencing receptor binding, membrane fusion, or capsid release.

Human

HEK293

Tag Free

P48509 (G2-Y253)

977

Full Length

GEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY

Solution.

Supplied as 0.2 μm filtered solution of PBS, Arginine, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.