1. Recombinant Proteins
  2. CD Antigens Biotinylated Proteins
  3. T Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins
  4. CD150
  5. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi)

CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72413
Handling Instructions Technical Support

CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

CD150/SLAMF1, a self-ligand receptor belonging to the signaling lymphocytic activation molecule (SLAM) family, plays a pivotal role in modulating the activation and differentiation of various immune cells, thereby contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of CD150 are regulated by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150 induces distinct signal transduction events in T-lymphocytes compared to B-cells, involving two modes of signaling—one dependent on SH2D1A (and possibly SH2D1B) and another reliant on protein-tyrosine phosphatase 2C (PTPN11). CD150 mediates IL-2-independent proliferation of activated T-cells, induces IFN-gamma production, and participates in downstream signaling pathways involving INPP5D, DOK1, DOK2, PRKCQ, BCL10, and NFKB1. Furthermore, it plays crucial roles in the differentiation of T follicular helper cells, the regulation of allergic responses, and the modulation of innate immune responses against Gram-negative bacteria in macrophages. Additionally, CD150 acts as a receptor for Measles virus, including isoform 4.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q13291-1 (A21-P237)

Gene ID
Molecular Construction
N-term
SLAMF1 (A21-P237)
Accession # Q13291-1
6*His-Avi
C-term
Protein Length

Extracellular Domain

Synonyms
Signaling Lymphocytic Activation Molecule; CDw150; IPO-3; CD150; SLAMF1; SLAM
AA Sequence

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

Molecular Weight

45-65 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72413
Quantity:
MCE Japan Authorized Agent: