1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD14
  5. CD14 Protein, Mouse (HEK293, His)

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD14 encodes a protein pivotal in the innate immune response and prominently expressed in monocyte/macrophage cells. Functioning as a co-receptor, it binds various microbial and fungal molecules, including lipopolysaccharides (LPS). The LPS-binding activity of this protein is potentiated by the LPS binding protein (LBP), facilitating binding to the TLR4-MD-2 co-receptor complex. CD14 exists in two forms—soluble and cell surface-anchored by a glycosylphosphatidylinositol anchor. Its broad expression is observed across diverse tissues, such as the mammary gland and colon, highlighting its crucial role in immune-related processes.

Biological Activity

Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED50 this effect is 1.121 μg/mL, corresponding to a specific activity is 892.06 U/mg.

  • Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL -2 cells. The ED50 this effect is 1.121 μg/ml, corresponding to a specific activity is 892.06 U/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P10810/NP_033971.1 (S16-P345)

Gene ID
Molecular Construction
N-term
CD14 (S16-P345)
Accession # P10810/NP_033971.1
6*His
C-term
Protein Length

Partial

Synonyms
rHuCD14, His; Monocyte Differentiation Antigen CD14; Myeloid Cell-Specific Leucine-Rich Glycoprotein; CD14
AA Sequence

MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLFV

Molecular Weight

Approximately 45-50 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD14 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73531
Quantity:
MCE Japan Authorized Agent: