1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. B Cell CD Proteins NK Cell CD Proteins Stem Cell CD Proteins Receptor Tyrosine Kinases Pattern Recognition Receptors
  4. CD117/c-KIT C-type Lectin Receptors
  5. CLEC2D
  6. CD117/c-Kit Protein, Mouse (HEK293, Fc)

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis . CD117/c-Kit Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis . CD117/c-Kit Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD117/c-Kit protein is a tyrosine-protein kinase that serves as a cell-surface receptor for the cytokine KITLG/SCF. It plays a crucial role in regulating cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis. Upon binding to KITLG/SCF, CD117/c-Kit activates multiple signaling pathways, including PI3K/AKT, GRB2/RAS/RAF/MAPK, and STAT. This leads to the phosphorylation of various downstream effectors such as PIK3R1, PLCG1, SH2B2/APS, CBL, and transcription factors STAT1, STAT3, STAT5A, and STAT5B. Activation of PLCG1 results in the production of diacylglycerol and inositol 1,4,5-trisphosphate, important cellular signaling molecules. CD117/c-Kit signaling is regulated by protein phosphatases, rapid internalization, and degradation of the receptor. Additionally, it promotes the phosphorylation of PTPN6/SHP-1, PTPRU, and other proteins like CRK, LYN, SRC, and SHC1.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117 is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c‑kit Ligand. The ED50 for this effect is 30.7 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117 is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand.The ED50 for this effect is 30.7 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P05532 (S25-T523)

Gene ID
Molecular Construction
N-term
KIT (S25-T523)
Accession # P05532
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl
AA Sequence

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

Molecular Weight

100-120 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD117/c-Kit Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P72879
Quantity:
MCE Japan Authorized Agent: