1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins
  4. CD105/Endoglin Protein, Mouse (HEK293, C-His)

CD105/Endoglin Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD105/Endoglin, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD105/Endoglin Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD105/Endoglin, expressed by HEK293 , with C-10*His labeled tag.

Background

CD105/Endoglin Protein is a vascular endothelium glycoprotein that plays a crucial role in angiogenesis regulation, maintaining the structure and integrity of adult vasculature. It also controls the migration of vascular endothelial cells and contributes to extraembryonic angiogenesis and embryonic heart development. CD105/Endoglin Protein is involved in endothelial cell shape changes in response to blood flow, facilitating vascular remodeling during angiogenesis. Additionally, it acts as a coreceptor for TGF-beta, participating in the TGF-beta/BMP signaling cascade and activating SMAD transcription factors. CD105/Endoglin Protein forms dimers and interacts with various receptors, including TGFBR1, TGFBR2, GDF2, ACVRL1, BMP10, DYNLT4, and ARRB2.

Biological Activity

Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED50 for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.

  • Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED50 for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

NP_031958.2 (E27-K580)

Gene ID

13805

Protein Length

Partial

Synonyms
Endoglin; END; CD105; ENG; Cell surface MJ7/18 antigen
AA Sequence

ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGK

Molecular Weight

Approximately 75-85 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD105/Endoglin Protein, Mouse (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD105/Endoglin Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P75446A
Quantity:
MCE Japan Authorized Agent: