1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CC Chemokine Receptor Chemokine Receptor
  5. CCR9
  6. CCR9 Protein, Human (GST)

CCR9 Protein, a receptor for SCYA25/TECK, activates signaling, elevating intracellular calcium ions. In microbial infection, it acts as an alternative HIV-1 coreceptor with CD4, influencing the infection process. CCR9 Protein, Human (GST) is the recombinant human-derived CCR9 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCR9 Protein, a receptor for SCYA25/TECK, activates signaling, elevating intracellular calcium ions. In microbial infection, it acts as an alternative HIV-1 coreceptor with CD4, influencing the infection process. CCR9 Protein, Human (GST) is the recombinant human-derived CCR9 protein, expressed by E. coli , with N-GST labeled tag.

Background

The CCR9 Protein functions as a receptor for the chemokine SCYA25/TECK, leading to the transduction of a signal that increases intracellular calcium ion levels. In the context of microbial infection, it acts as an alternative coreceptor with CD4 for HIV-1, contributing to the infection process.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P51686-1 (M1-S48)

Gene ID
Molecular Construction
N-term
GST
CCR9 (M1-S48)
Accession # P51686-1
C-term
Protein Length

Extracellular Domain

Synonyms
chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9;
AA Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS

Molecular Weight

33 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCR9 Protein, Human (GST)
Cat. No.:
HY-P700544
Quantity:
MCE Japan Authorized Agent: