CCR5 Protein, Mouse (P. pastoris, His)

CCR5 protein is a receptor for inflammatory CC chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, and plays a crucial role in signal transduction by increasing intracellular calcium levels. . It acts as a chemoattractant receptor and contributes to granulocyte lineage control and T lymphocyte migration to sites of infection. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris , with N-6*His labeled tag.

CCR5 Protein, functioning as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a pivotal role in transducing signals by elevating intracellular calcium ion levels. This receptor may contribute to the control of granulocytic lineage proliferation or differentiation and is integral to T-lymphocyte migration to infection sites, functioning as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 further underscore the complexity of CCR5's regulatory network. Notably, efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta necessitates sulfation, O-glycosylation, and sialic acid modifications. Additionally, glycosylation on Ser-6 is essential for optimal CCL4 binding. The interaction with S100A4 highlights a stimulating effect on T-lymphocyte chemotaxis, emphasizing the multifaceted roles of CCR5 in immune responses and cellular signaling pathways.

Mouse

P. pastoris

N-6*His

P51682 (Q263-L354)

12774  [NCBI]

QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

12.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.