1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. CBR1 Protein, Human (P.pastoris, His)

CBR1 is an NADPH-dependent reductase with broad substrate specificity and plays a key role in the reduction of various carbonyl compounds, including quinones, prostaglandins, menadione, and xenobiotics. Crucially, CBR1 converts the anthracyclines doxorubicin and daunorubicin into their cardiotoxic forms doxorubicin and daunorubicin. CBR1 Protein, Human (P.pastoris, His) is the recombinant human-derived CBR1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CBR1 is an NADPH-dependent reductase with broad substrate specificity and plays a key role in the reduction of various carbonyl compounds, including quinones, prostaglandins, menadione, and xenobiotics. Crucially, CBR1 converts the anthracyclines doxorubicin and daunorubicin into their cardiotoxic forms doxorubicin and daunorubicin. CBR1 Protein, Human (P.pastoris, His) is the recombinant human-derived CBR1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

CBR1, an NADPH-dependent reductase, exhibits broad substrate specificity and plays a pivotal role in the reduction of diverse carbonyl compounds, encompassing quinones, prostaglandins, menadione, and various xenobiotics. Notably, CBR1 catalyzes the conversion of the antitumor anthracyclines doxorubicin and daunorubicin into their cardiotoxic counterparts, doxorubicinol and daunorubicinol. Moreover, it demonstrates the ability to transform prostaglandin E into prostaglandin F2-alpha, highlighting its versatility in substrate recognition. The enzyme's interaction with glutathione, evidenced by binding to glutathione-conjugated substrates, further elucidates its higher affinity for specific compounds. Additionally, CBR1 participates in glucocorticoid metabolism by facilitating the NADPH-dependent conversion of cortisol/corticosterone to 20beta-dihydrocortisol (20b-DHF) or 20beta-corticosterone (20b-DHB), both of which act as weak agonists for NR3C1 and NR3C2 in adipose tissue.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P16152 (S2-W277)

Gene ID

873  [NCBI]

Molecular Construction
N-term
6*His
CBR1 (S2-W277)
Accession # P16152
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Carbonyl Reductase 1; SDR21C1
AA Sequence

SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Molecular Weight

Approximately 33.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 3% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CBR1 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CBR1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P72272
Quantity:
MCE Japan Authorized Agent: