Caveolin-1/CAV1 Protein, Human (Cell-Free, His)

Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.

Caveolin-1/CAV1 protein serves as a pivotal scaffolding component within caveolar membranes, as demonstrated by its interactions and functional associations. It forms a stable heterooligomeric complex with CAV2, directing its localization to lipid rafts and driving the formation of caveolae. In addition to its role in membrane organization, CAV1 mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae, contributing to the complexity of cellular signaling. This multifunctional protein directly interacts with G-protein alpha subunits, regulating their activity and playing a role in the costimulatory signal crucial for T-cell receptor (TCR)-mediated T-cell activation. The binding of CAV1 to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Moreover, CAV1 recruits CTNNB1 to caveolar membranes, potentially modulating CTNNB1-mediated signaling through the Wnt pathway. Notably, CAV1 negatively regulates TGFB1-mediated activation of SMAD2/3 by facilitating the internalization of TGFBR1 from membrane rafts, leading to subsequent degradation. Through homooligomerization and diverse interactions with proteins like GLIPR2, NOSTRIN, SNAP25, STX1A, DPP4, CTNNB1, CDH1, JUP, PACSIN2, SLC7A9, BMX, BTK, TGFBR1, CAVIN3, EHD2, UBXN6, VCP, ABCG1, NEU3, and SPRY family members, CAV1 orchestrates a spectrum of cellular functions, including membrane dynamics, signaling regulation, cholesterol homeostasis, and lysosomal targeting.

Human

E. coli Cell-free

N-10*His

Q03135 (M1-I178)

857

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Greater than 90% as determined by reducing SDS-PAGE. .