1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin V/Cathepsin L2
  5. Cathepsin L2 Protein, Human (HEK293, His, solution)

Cathepsin L2 Protein, Human (HEK293, His, solution)

Cat. No.: HY-P7755A
Handling Instructions Technical Support

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Cathepsin L2, a cysteine protease, is anticipated to hold a significant role in corneal physiology. The precise functions and mechanisms of action associated with this protease in corneal processes are subjects of ongoing investigation. The distinct properties of Cathepsin L2 suggest its potential involvement in critical cellular and molecular events within the cornea, emphasizing its importance in maintaining the health and functionality of this ocular tissue. Further research is warranted to elucidate the specific contributions and regulatory pathways through which Cathepsin L2 influences corneal physiology.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-His

Accession

O60911 (V18-V334)

Gene ID
Molecular Construction
N-term
Cathepsin L2 (V18-V334)
Accession # O60911
His
C-term
Synonyms
Cathepsin L2; Cathepsin U; Cathepsin V; CTSL2; CATL2; CTSU; CTSV
AA Sequence

VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVHHHHHH

Molecular Weight

Approximately 33-38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cathepsin L2 Protein, Human (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin L2 Protein, Human (HEK293, His, solution)
Cat. No.:
HY-P7755A
Quantity:
MCE Japan Authorized Agent: