1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin B
  5. Cathepsin B Protein, Rat (HEK293, His)

Cathepsin B is a lysosomal cysteine protease that plays a role in intracellular protein catabolism. Cathepsin B mediates JNK signaling pathway to regulate the migration of glioma initiation cells. Cathepsin B is involved in the pathology of chronic inflammatory diseases of the airway and joints, as well as cancer and pancreatitis. Cathepsin B Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Cathepsin B Protein, Rat (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin B is a lysosomal cysteine protease that plays a role in intracellular protein catabolism. Cathepsin B mediates JNK signaling pathway to regulate the migration of glioma initiation cells. Cathepsin B is involved in the pathology of chronic inflammatory diseases of the airway and joints, as well as cancer and pancreatitis. Cathepsin B Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag.

Background

Cathepsin B is a lysosomal cysteine protease that plays a role in intracellular protein catabolism and is involved in other physiological processes such as antigen processing in immune response, hormone activation, and bone turnover. Cathepsin B mediates JNK signaling pathway to regulate the migration of glioma initiation cells. Cathepsin B can enhance the activity of other proteases, including matrix metalloproteinases, urokinase (serine protease urokinase plasminogen activator), and Cathepsin D. Cathepsin B is involved in the pathology of chronic inflammatory diseases of the airway and joints, as well as cancer and pancreatitis[1][2][3].

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC . The specific activity is >2,500 pmol/min/μg. (Activation description: The proenzyme needs to be activated in acid reducing buffer for an activated form.)

Assay Procedure

Materials
Activation buffer: 25 mM MES, 5 mM DTT, pH 5.0
Assay buffer: 25 mM MES, pH 5.0
Cathepsin B Protein, Rat (HEK293, His) (HY-P74345)
Substrate: Z-Leu-Arg-AMC (HY-142021)
Standard: 7-Amino-4-methylcoumarin (AMC, HY-D0027)

Procedure
1. Dilute AMC to 0, 0.78125, 1.5625, 3.125, 6.25, 12.5, 25, 50, and 100 μmol/L respectively with assay buffer.
2. Add 100 μL of each dilution to black microplate wells.
3. Set excitation and emission wavelengths to 380 nm and 460 nm (top read), and read in kinetic mode for 5 minutes.
4. Plot a standard curve with the measured RFU as the abscissa and the amount of standard substance as the ordinate, and obtain the standard curve equation.
5. Dilute the test protein to 10 μg/mL with activation buffer; dilute Rat Cathepsin B to 100 μg/mL with assay buffer.
6. Incubate at room temperature for 15 minutes.
7. Dilute Rat Cathepsin B to 0.2 μg/mL with assay buffer.
8. Dilute the substrate to 20 μM with assay buffer.
9. Add 50 μL of the test protein at each concentration to the assay wells, and initiate the reaction by adding 50 μL of 20 μM substrate. For blank wells, add 50 μL of assay buffer and 50 μL of 20 μM substrate without protein.
10. Set excitation and emission wavelengths to 380 nm and 460 nm (top read), and read in kinetic mode for 5 minutes.
11. Calculate the specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Per Well:
Rat Cathepsin B: 0.01 μg
Substrate: 10 μM

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q6IN22 (H18-F339)

Gene ID
Molecular Construction
N-term
Cathepsin B (H18-F339)
Accession # Q6IN22
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cathepsin B; APPS; CTSB; CPSB
AA Sequence

HDKPSFHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.5. or PBS, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin B Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin B Protein, Rat (HEK293, His)
Cat. No.:
HY-P74345
Quantity:
MCE Japan Authorized Agent: