1. Recombinant Proteins
  2. Others
  3. Calcium-sensing R/CaSR Protein, Human (HEK293, His)

Calcium-sensing R/CaSR Protein, Human (HEK293, His)

Cat. No.: HY-P79408
Handling Instructions Technical Support

Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing R/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing R/CaSR protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing R/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing R/CaSR protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Calcium-sensing R/CaSR protein, a G-protein-coupled receptor, plays a pivotal role in detecting changes in extracellular calcium concentration, crucial for maintaining calcium homeostasis. This receptor senses fluctuations in circulating calcium levels and modulates the production of parathyroid hormone (PTH) in parathyroid glands. Its activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. The receptor's activation involves a co-agonist mechanism, where aromatic amino acids such as Trp or Phe, in concert with divalent cations like calcium or magnesium, achieve full activation. In the resting state, the receptor adopts an open conformation, with anion binding promoting the inactive configuration. Upon aromatic amino acid binding, the extracellular venus flytrap module groove closes, inducing a novel homodimer interface between subunits. Calcium ions further stabilize the active state by enhancing homodimer interactions between membrane-proximal domains. Notably, the receptor can be activated by AMG 416, a D-amino acid-containing peptide agonist under evaluation for treating secondary hyperparathyroidism in chronic kidney disease patients receiving hemodialysis, with AMG 416 acting through the formation of a disulfide bond with Cys-482.

Biological Activity

Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.

  • Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P41180-1 (Y20-K601)

Gene ID

846  [NCBI]

Molecular Construction
N-term
CASR (Y20-K601)
Accession # P41180-1
6*His
C-term
Synonyms
Extracellular calcium-sensing receptor; CASR; CaR; hCasR; Parathyroid cell calcium-sensing receptor 1; PCaR1; Calcium-sensing Receptor
AA Sequence

YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK

Molecular Weight

approximately 95-130 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Calcium-sensing R/CaSR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcium-sensing R/CaSR Protein, Human (HEK293, His)
Cat. No.:
HY-P79408
Quantity:
MCE Japan Authorized Agent: