1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. CT Receptor (Calcitonin Receptor)
  5. Calcitonin R Protein, Human (HEK293, hFc)

Calcitonin R protein, a receptor for calcitonin, utilizes G proteins to activate adenylyl cyclase. Despite being sensitive to cholera toxin, it exhibits limited coupling to G proteins, leading to the inability to effectively activate adenylyl cyclase. Notably, following ligand binding, Calcitonin R does not undergo the conventional process of receptor internalization. Calcitonin R Protein, Human (HEK293, hFc) is the recombinant human-derived Calcitonin R, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Calcitonin R protein, a receptor for calcitonin, utilizes G proteins to activate adenylyl cyclase. Despite being sensitive to cholera toxin, it exhibits limited coupling to G proteins, leading to the inability to effectively activate adenylyl cyclase. Notably, following ligand binding, Calcitonin R does not undergo the conventional process of receptor internalization. Calcitonin R Protein, Human (HEK293, hFc) is the recombinant human-derived Calcitonin R, expressed by HEK293 , with N-hFc labeled tag.

Background

The Calcitonin R protein serves as a receptor for calcitonin, exerting its activity through G proteins that subsequently activate adenylyl cyclase. This receptor is believed to couple with a heterotrimeric G protein sensitive to cholera toxin. However, it is noteworthy that while the Calcitonin R serves as a receptor for calcitonin, it does not effectively couple to G proteins, resulting in the inability to activate adenylyl cyclase. Additionally, following ligand binding, this receptor does not undergo the typical process of receptor internalization.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Calcitonin at 2μg/mL (100μL/well) can bind Biotinylated Human Calcitonin R. The ED50 for this effect is 4.532 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Calcitonin at 2μg/mL (100μL/well) can bind Biotinylated Human Calcitonin R. The ED50 for this effect is 4.532μg/mL.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

P30988 (A25-V154)

Gene ID

799  [NCBI]

Molecular Construction
N-term
hFc
CALCR (A25-V154)
Accession # P30988
C-term
Protein Length

Partial

Synonyms
Calcitonin R; Calcitonin receptor; CALCR; CRT; CTR; CTR1
AA Sequence

AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIV

Molecular Weight

Approximately 55-75 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Calcitonin R Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcitonin R Protein, Human (HEK293, hFc)
Cat. No.:
HY-P74359
Quantity:
MCE Japan Authorized Agent: