1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Cell Adhesion Molecule 2 (CADM2)
  6. CADM2/IGSF4D Protein, Human (HEK293, His)

CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag.

Background

CADM2, also known as IGSF4D, serves as an adhesion molecule facilitating both homo- and heterophilic interactions with other members of the nectin-like family, thereby promoting cell aggregation. This protein holds significance in synapse organization, playing a crucial role in regulated trans-synaptic adhesion. Notably, CADM2 exhibits a preference for binding to oligodendrocytes, emphasizing its involvement in cellular interactions within the nervous system.

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.052 μg/mL, corresponding to a specific activity is 950.570 units/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8N3J6-2 (G30-D335)

Gene ID
Molecular Construction
N-term
CADM2 (G30-D335)
Accession # Q8N3J6
His
C-term
Protein Length

Partial

Synonyms
Cell adhesion molecule 2; NECL-3; SynCAM 2; IGSF4D
AA Sequence

GSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPD

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CADM2/IGSF4D Protein, Human (HEK293, His)
Cat. No.:
HY-P75599
Quantity:
MCE Japan Authorized Agent: